McDonnell Genome Institute

Washington University

Transcript

lnc-RAB23-53:13

Chromosome

chr6

Gene Name

lnc-RAB23-53

Start

57941473

CPC Label

coding

End

57961395

Cancer

OV

Strand

-

Peptide

KQGELGAK

Modified Peptide

n[145]KQGELGAK

Peptide Length

8

ORF Length

85

Open Reading Frame (ORF)

LTVRPEGEDEPRVQMLLPPPEVWRDWLKKQGELGAKQAHSFFFFFSFHGDGVSLCGPGCSVVVLSQFTATSAFWVPAILLPQCPE

Conservation Score

0.702

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.621262

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9737

PhyloCSF Frame 3

0

CNTI Score

-0.328683288