McDonnell Genome Institute

Washington University

Transcript

lnc-RAB23-1:2

Chromosome

chr6

Gene Name

lnc-RAB23-1

Start

57260533

CPC Label

coding

End

57262678

Cancer

BRCA-Luminal B

Strand

-

Peptide

LVLNLFFK

Modified Peptide

n[145]LVLNLFFK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LVLNLFFKISRIFRILTDRGNYHMGEPQPSQKSMREMKIHMACIS

Conservation Score

0.334

PhyloCSF Frame 1

-5.542

No. of Spectra

14

CPC Coding Probability

0.5

PhyloCSF Frame 2 

-5.142

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

-5.258

CNTI Score

-0.336128346