McDonnell Genome Institute

Washington University

Transcript

lnc-RAB1A-2:1

Chromosome

chr2

Gene Name

lnc-RAB1A-2

Start

65030746

CPC Label

noncoding

End

65053017

Cancer

OV

Strand

-

Peptide

LTSVDPPALVSQIAGITGVSHHTWSDPR

Modified Peptide

n[145]LTSVDPPALVSQIAGITGVSHHTWSDPR

Peptide Length

28

ORF Length

42

Open Reading Frame (ORF)

LTSVDPPALVSQIAGITGVSHHTWSDPRYFELNRTATNIHIK

Conservation Score

0.101

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00835771

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2738

PhyloCSF Frame 3

0

CNTI Score

-0.453090642