McDonnell Genome Institute

Washington University

Transcript

lnc-RAB1A-11:8

Chromosome

chr2

Gene Name

lnc-RAB1A-11

Start

65185003

CPC Label

noncoding

End

65227598

Cancer

EOGC

Strand

-

Peptide

VIFSMNDVGGK

Modified Peptide

n[145]VIFSMNDVGGK

Peptide Length

11

ORF Length

44

Open Reading Frame (ORF)

LIFNNGAKTIHGERVIFSMNDVGGKKKNFDSYLTSHIKIDLSGS

Conservation Score

0.371

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0493126

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.332875022