McDonnell Genome Institute

Washington University

Transcript

lnc-RAB1A-11:3

Chromosome

chr2

Gene Name

lnc-RAB1A-11

Start

65225644

CPC Label

noncoding

End

65227945

Cancer

OV

Strand

-

Peptide

SCVCSILQCQPTPSLPK

Modified Peptide

n[145]SCVCSILQCQPTPSLPK

Peptide Length

17

ORF Length

103

Open Reading Frame (ORF)

LLRQWNVAEKLAGRAGSKPGGPGGPHHSTGLGVLLLLGLFSGQNWDGYTHAYLKSCVCSILQCQPTPSLPKLLYGQVSESRCLHFQPRGSPPPSSSPMLLHTS

Conservation Score

0.271

PhyloCSF Frame 1

-3.473

No. of Spectra

7

CPC Coding Probability

0.381937

PhyloCSF Frame 2 

-4.048

CNTI Index

noncoding

Max Probability

0.9615

PhyloCSF Frame 3

-1.809

CNTI Score

-0.308924238