McDonnell Genome Institute

Washington University

Transcript

lnc-RAB1A-11:2

Chromosome

chr2

Gene Name

lnc-RAB1A-11

Start

65207651

CPC Label

noncoding

End

65228398

Cancer

OV

Strand

-

Peptide

GGGIFSK

Modified Peptide

n[145]GGGIFSK

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

LQQIVDRINVCACMCVCALRCACVCRRGGGIFSKWKEI

Conservation Score

0.442

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.149542

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8023

PhyloCSF Frame 3

0

CNTI Score

0.722333025