McDonnell Genome Institute

Washington University

Transcript

lnc-RAB1A-1:1

Chromosome

chr2

Gene Name

lnc-RAB1A-1

Start

65046569

CPC Label

noncoding

End

65056183

Cancer

OV

Strand

-

Peptide

LQDPAARPRPEQMEMGCHVVSCPMGK

Modified Peptide

n[145]LQDPAARPRPEQM[147]EMGCHVVSCPM[147]GK

Peptide Length

26

ORF Length

82

Open Reading Frame (ORF)

MRTFVHFALDALMFPARRRAAVTRLSERLSLCFCLHSRLQDPAARPRPEQMEMGCHVVSCPMGKRLTCEELREASRKQPVKN

Conservation Score

0.978

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.101645

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3277

PhyloCSF Frame 3

0

CNTI Score

-0.309165366