McDonnell Genome Institute

Washington University

Transcript

lnc-RAB19-2:1

Chromosome

chr7

Gene Name

lnc-RAB19-2

Start

140282464

CPC Label

noncoding

End

140282920

Cancer

OV

Strand

+

Peptide

DLHHINAELCLLR

Modified Peptide

n[145]DLHHINAELCLLR

Peptide Length

13

ORF Length

71

Open Reading Frame (ORF)

MKVILSNHTISIPESISLTRKGHTGIGKGPRRTLWRDLHHINAELCLLRKERKRLQADKGWEVGRNWPHCL

Conservation Score

1

PhyloCSF Frame 1

-4.368

No. of Spectra

5

CPC Coding Probability

0.332347

PhyloCSF Frame 2 

-4.331

CNTI Index

noncoding

Max Probability

0.7243

PhyloCSF Frame 3

-2.891

CNTI Score

-0.415485005