McDonnell Genome Institute

Washington University

Transcript

lnc-RAB17-6:5

Chromosome

chr2

Gene Name

lnc-RAB17-6

Start

237685762

CPC Label

coding

End

237691859

Cancer

LUAD

Strand

-

Peptide

ASVEESNR

Modified Peptide

n[230]ASVEESNR

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LIELNLNWRQKASVEESNRHLSTHYRLVKGDDKIRQHAQNRKEPEGRNLETLTWEG

Conservation Score

0.129

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.572625

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-2.141

CNTI Score

-0.265347703