McDonnell Genome Institute

Washington University

Transcript

lnc-RAB17-6:1

Chromosome

chr2

Gene Name

lnc-RAB17-6

Start

237676119

CPC Label

noncoding

End

237691859

Cancer

OV

Strand

-

Peptide

GSLGPSTAAPAGR

Modified Peptide

n[145]GSLGPSTAAPAGR

Peptide Length

13

ORF Length

100

Open Reading Frame (ORF)

LSITTPPAPAGKRTWRKRPLRLRPQLHPQGPWEAGAPGRMPRPVGVDPKRGSPPGGDLPGAGRGYEFPAPPHPSPSGHAELPGRGSLGPSTAAPAGRAPH

Conservation Score

0.3

PhyloCSF Frame 1

-0.313

No. of Spectra

10

CPC Coding Probability

0.040963

PhyloCSF Frame 2 

-2.889

CNTI Index

noncoding

Max Probability

0.9398

PhyloCSF Frame 3

-3.164

CNTI Score

-0.265347703