McDonnell Genome Institute

Washington University

Transcript

lnc-RAB17-1:3

Chromosome

chr2

Gene Name

lnc-RAB17-1

Start

237538882

CPC Label

noncoding

End

237551301

Cancer

OV

Strand

-

Peptide

LEAQGPASVR

Modified Peptide

n[145]LEAQGPASVR

Peptide Length

10

ORF Length

111

Open Reading Frame (ORF)

LEAQGPASVRGWPLQTVKSSRGHAWQMLGSEETAKWPNSPGNFSWCLAPWDFAWLGLWAAARGTAEAVRLGFQGQRWKRPHQRRVWVSGMAWAETPLSLPVCDLDQAHPLP

Conservation Score

0.065

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.116817

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

0

CNTI Score

-0.333791105