McDonnell Genome Institute

Washington University

Transcript

lnc-RAB12-2:2

Chromosome

chr18

Gene Name

lnc-RAB12-2

Start

8545634

CPC Label

coding

End

8546817

Cancer

EOGC

Strand

+

Peptide

ELNPVLPVQGSIVTAYSPLGSPDRPR

Modified Peptide

n[145]ELNPVLPVQGSIVTAYSPLGSPDRPR

Peptide Length

26

ORF Length

82

Open Reading Frame (ORF)

LLASPTSPSPGREDLKQIWLKVKAGNSRELNPVLPVQGSIVTAYSPLGSPDRPRAKPEDPSLLEDPRIKVIAAKHNETVARF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.577348

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1172

PhyloCSF Frame 3

0

CNTI Score

-0.27931311