McDonnell Genome Institute

Washington University

Transcript

lnc-RAB11FIP4-3:1

Chromosome

chr17

Gene Name

lnc-RAB11FIP4-3

Start

31691962

CPC Label

noncoding

End

31696926

Cancer

OV

Strand

+

Peptide

EGPSGPAPKPPRLGEAWTHESNSSPK

Modified Peptide

n[145]EGPSGPAPKPPRLGEAWTHESNSSPK

Peptide Length

26

ORF Length

86

Open Reading Frame (ORF)

LHLHWKPRRVLHMPETMRTLCEVQSMQDQVREGPSGPAPKPPRLGEAWTHESNSSPKQERIIRLDPWEAGCKTAELSQDMRKLSHT

Conservation Score

0.652

PhyloCSF Frame 1

-4.358

No. of Spectra

1

CPC Coding Probability

0.0779634

PhyloCSF Frame 2 

-4.833

CNTI Index

noncoding

Max Probability

0.1096

PhyloCSF Frame 3

-4.145

CNTI Score

-0.382883229