McDonnell Genome Institute

Washington University

Transcript

lnc-RAB10-4:1

Chromosome

chr2

Gene Name

lnc-RAB10-4

Start

25822468

CPC Label

noncoding

End

25822950

Cancer

HCC

Strand

+

Peptide

DYVFTEFCEHSK

Modified Peptide

n[230]DYVFTEFCEHSK

Peptide Length

12

ORF Length

43

Open Reading Frame (ORF)

MQPASAKWYYRRDYVFTEFCEHSKDVHVNFEKSKLNIQLSQRK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.021087

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4753

PhyloCSF Frame 3

0

CNTI Score

-0.373310926