McDonnell Genome Institute

Washington University

Transcript

lnc-RAB10-2:1

Chromosome

chr2

Gene Name

lnc-RAB10-2

Start

25994793

CPC Label

coding

End

25995081

Cancer

CCRC

Strand

+

Peptide

EEEEEEGELVFLHQDPLTTVR

Modified Peptide

‚Äč

Peptide Length

21

ORF Length

93

Open Reading Frame (ORF)

LEDERKMLTESGDPKEEEEEEGELVFLHQDPLTTVREQCQQLEKCVKAQEWLELCDECVSSQSHTEEDCTEELFDFLHATDHCVAHKLFNNLK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.600702

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

0

CNTI Score

-0.302780325