McDonnell Genome Institute

Washington University

Transcript

lnc-R3HCC1L-2:1

Chromosome

chr10

Gene Name

lnc-R3HCC1L-2

Start

98268467

CPC Label

noncoding

End

98272378

Cancer

OSCC

Strand

+

Peptide

QFPLLQNK

Modified Peptide

n[145]QFPLLQNK

Peptide Length

8

ORF Length

33

Open Reading Frame (ORF)

LGPRLFCREGRGGLGSPSPRQFPLLQNKVMTPT

Conservation Score

0.032

PhyloCSF Frame 1

-5.167

No. of Spectra

14

CPC Coding Probability

0.0641549

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.987

PhyloCSF Frame 3

0

CNTI Score

-0.358892692