McDonnell Genome Institute

Washington University

Transcript

lnc-R3HCC1-5:1

Chromosome

chr8

Gene Name

lnc-R3HCC1-5

Start

23355541

CPC Label

noncoding

End

23360018

Cancer

CCRC

Strand

+

Peptide

LADTELLVNHCR

Modified Peptide

LADTELLVNHCR

Peptide Length

12

ORF Length

123

Open Reading Frame (ORF)

LADTELLVNHCRFKDLFFFFFFETGSRPVVTQAGMQWHHHGSLQPPLPTVNQSFHLSLPGSWDHRHMPPCHVNFFNLVETRSCHIAQAGLKLLGSSNLPTSATQSAGITDVSQPNRPFKKKDQ

Conservation Score

0.386

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.0635967

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.32368125