McDonnell Genome Institute

Washington University

Transcript

lnc-QRSL1-5:1

Chromosome

chr6

Gene Name

lnc-QRSL1-5

Start

106769437

CPC Label

noncoding

End

106776532

Cancer

OV

Strand

+

Peptide

LHSFNTHQISR

Modified Peptide

n[145]LHSFNTHQISR

Peptide Length

11

ORF Length

57

Open Reading Frame (ORF)

LHSFNTHQISRNSTFVKIQGKAFFASFRTLPLVTALETHIIHSHAAPSAISGTIYLY

Conservation Score

0.599

PhyloCSF Frame 1

-4.437

No. of Spectra

8

CPC Coding Probability

0.0604328

PhyloCSF Frame 2 

-4.908

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-3.838

CNTI Score

-0.366112639