McDonnell Genome Institute

Washington University

Transcript

lnc-QRFP-6:2

Chromosome

chr9

Gene Name

lnc-QRFP-6

Start

130832352

CPC Label

noncoding

End

130835169

Cancer

HCC

Strand

-

Peptide

IFTWLCQK

Modified Peptide

n[230]IFTWLCQK

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

MTKTRVSSVPQEWLSNKIFTWLCQKQHIKTPVGQDVTSVYHRGSRPGCH

Conservation Score

1

PhyloCSF Frame 1

-4.97

No. of Spectra

17

CPC Coding Probability

0.0221267

PhyloCSF Frame 2 

-4.809

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-4.297

CNTI Score

-0.308050158