McDonnell Genome Institute

Washington University

Transcript

lnc-QKI-8:1

Chromosome

chr6

Gene Name

lnc-QKI-8

Start

163693166

CPC Label

noncoding

End

163694605

Cancer

OSCC

Strand

+

Peptide

SIEMPGIALHSQK

Modified Peptide

n[145]SIEMPGIALHSQK

Peptide Length

13

ORF Length

92

Open Reading Frame (ORF)

MMWLCCESSFPHREEVAGGATPFICSLVRGFPSAVAGLLKCVLTLGRCRVLLPEKDEVGSSKSIEMPGIALHSQKFLEQGMYHCLPIQILAM

Conservation Score

0.122

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.287094

PhyloCSF Frame 2 

-4.393

CNTI Index

noncoding

Max Probability

0.543

PhyloCSF Frame 3

-5.019

CNTI Score

-0.411377607