McDonnell Genome Institute

Washington University

Transcript

lnc-QDPR-3:1

Chromosome

chr4

Gene Name

lnc-QDPR-3

Start

17427695

CPC Label

noncoding

End

17428274

Cancer

EOGC

Strand

-

Peptide

AQQNNVEHRVETFSGVYK

Modified Peptide

n[145]AQQNNVEHRVETFSGVYK

Peptide Length

18

ORF Length

73

Open Reading Frame (ORF)

LTAMHGAILEDLVFPSEIVHKRLCMKLDGSRLMKVHSDKAQQNNVEHRVETFSGVYKKLTGKDVNFEFQGFQL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.047232

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4032

PhyloCSF Frame 3

0

CNTI Score

-0.333845376