McDonnell Genome Institute

Washington University

Transcript

lnc-PYURF-2:7

Chromosome

chr4

Gene Name

lnc-PYURF-2

Start

88581482

CPC Label

noncoding

End

88592308

Cancer

OV

Strand

-

Peptide

LGQHIMTISLASMSCFK

Modified Peptide

n[145]LGQHIM[147]TISLASM[147]SCFK

Peptide Length

17

ORF Length

49

Open Reading Frame (ORF)

LGQHIMTISLASMSCFKMALNGSSISNSLNSRYVNCFEEAMVYFFLPFL

Conservation Score

0.996

PhyloCSF Frame 1

-3.525

No. of Spectra

2

CPC Coding Probability

0.102994

PhyloCSF Frame 2 

-0.907

CNTI Index

noncoding

Max Probability

0.9332

PhyloCSF Frame 3

-5.21

CNTI Score

-0.332197615