McDonnell Genome Institute

Washington University

Transcript

lnc-PYGL-1:1

Chromosome

chr14

Gene Name

lnc-PYGL-1

Start

50956258

CPC Label

noncoding

End

50962002

Cancer

OSCC

Strand

-

Peptide

LGSEESLRPAAAPSGR

Modified Peptide

n[145]LGSEESLRPAAAPSGR

Peptide Length

16

ORF Length

61

Open Reading Frame (ORF)

LGSEESLRPAAAPSGRWGATPPGRRPVWEVGGASARLPPRLGGVPNSSLRTGQDDDGGFVE

Conservation Score

0.159

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.153977

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6271

PhyloCSF Frame 3

0

CNTI Score

-0.349972162