McDonnell Genome Institute

Washington University

Transcript

lnc-PXDNL-4:1

Chromosome

chr8

Gene Name

lnc-PXDNL-4

Start

50762459

CPC Label

noncoding

End

50762798

Cancer

OV

Strand

-

Peptide

LMVYLETPK

Modified Peptide

n[145]LMVYLETPK

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

LMVYLETPKKHILGTKMIFACIKKVERADLIAYLKKATNELATALFITK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.143526

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7839

PhyloCSF Frame 3

0

CNTI Score

-0.402887108