McDonnell Genome Institute

Washington University

Transcript

lnc-PXDN-3:1

Chromosome

chr2

Gene Name

lnc-PXDN-3

Start

1546664

CPC Label

noncoding

End

1620113

Cancer

CCRC

Strand

-

Peptide

RTYVAQK

Modified Peptide

n[230]RTYVAQK

Peptide Length

7

ORF Length

49

Open Reading Frame (ORF)

LEDLGPGTQNLCPLRMYLKAGSMRHRALTFSNRRTYVAQKVGEASGEQP

Conservation Score

0.644

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0230438

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.322841233