McDonnell Genome Institute

Washington University

Transcript

lnc-PXDN-11:1

Chromosome

chr2

Gene Name

lnc-PXDN-11

Start

1462343

CPC Label

coding

End

1471602

Cancer

BRCA-Luminal A

Strand

-

Peptide

EIDITNK

Modified Peptide

n[145]EIDITNK

Peptide Length

7

ORF Length

116

Open Reading Frame (ORF)

LAMDPNQGEIPDLPEKEFRRLIIKLIRKAPEKGKAQCKEIRKMIQEVKGEIFKEIDITNKKQSKLQETLDTLREIQNVLESLSNRIKQAKENFRAQRQGLQINPIQQRQRKKNKKI

Conservation Score

0.313

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.617798

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5026

PhyloCSF Frame 3

0

CNTI Score

-0.332042051