McDonnell Genome Institute

Washington University

Transcript

lnc-PXDN-10:1

Chromosome

chr2

Gene Name

lnc-PXDN-10

Start

2284476

CPC Label

noncoding

End

2326554

Cancer

HCC

Strand

-

Peptide

SGPNTSGK

Modified Peptide

n[230]SGPNTSGK

Peptide Length

8

ORF Length

97

Open Reading Frame (ORF)

LQWCLAGLDGKGIAASIVTSKSGPNTSGKSSVFRGITSESWKRVFLVTWGFSVSLPTETTVRAVLCGKPAVAAPSCCSALDSHSLWIVGWWSAGARG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

23

CPC Coding Probability

0.0274714

PhyloCSF Frame 2 

-2.218

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.395233628