McDonnell Genome Institute

Washington University

Transcript

lnc-PXDN-1:1

Chromosome

chr2

Gene Name

lnc-PXDN-1

Start

1620509

CPC Label

noncoding

End

1625419

Cancer

EOGC

Strand

-

Peptide

GSFSSIMK

Modified Peptide

n[145]GSFSSIM[147]K

Peptide Length

8

ORF Length

134

Open Reading Frame (ORF)

LERRFRWGKIREHLDIYALSTEMRLQAKASKMQDSQSGSHIRRVPPSPSRILRRSSRLGLAHSTDLFLVSRDSRKQMSRPMGLLCAPRPTLPPAWDPASPESSCGPPWVVHMRSSLCKGSFSSIMKAPLVSDAP

Conservation Score

0.105

PhyloCSF Frame 1

-3.7

No. of Spectra

226

CPC Coding Probability

0.19605

PhyloCSF Frame 2 

-3.237

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-4.695

CNTI Score

-0.360604953