McDonnell Genome Institute

Washington University

Transcript

lnc-PXDC1-15:12

Chromosome

chr6

Gene Name

lnc-PXDC1-15

Start

3904909

CPC Label

noncoding

End

3911979

Cancer

EOGC

Strand

-

Peptide

LGMSNFIPFSEILK

Modified Peptide

n[145]LGMSNFIPFSEILK

Peptide Length

14

ORF Length

46

Open Reading Frame (ORF)

LGMSNFIPFSEILKRNTLMWLEVISQSLWMELMSVTGYEVVIYRTV

Conservation Score

0.319

PhyloCSF Frame 1

-4.8

No. of Spectra

15

CPC Coding Probability

0.216204

PhyloCSF Frame 2 

-5.208

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-4.773

CNTI Score

-0.317472295