McDonnell Genome Institute

Washington University

Transcript

lnc-PXDC1-15:1

Chromosome

chr6

Gene Name

lnc-PXDC1-15

Start

3884204

CPC Label

noncoding

End

3896928

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

SFHHLLDAR

Modified Peptide

n[145]SFHHLLDAR

Peptide Length

9

ORF Length

59

Open Reading Frame (ORF)

MRRILWKSFHHLLDARSALTHDSGVRLAKVRTAEMAGVYVLGEASLLNVAMARPPHSPL

Conservation Score

0.862

PhyloCSF Frame 1

-3.195

No. of Spectra

25

CPC Coding Probability

0.179356

PhyloCSF Frame 2 

-4.983

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-4.196

CNTI Score

-0.412335697