McDonnell Genome Institute

Washington University

Transcript

lnc-PWWP2B-1:3

Chromosome

chr10

Gene Name

lnc-PWWP2B-1

Start

132419005

CPC Label

coding

End

132435534

Cancer

BRCA-Luminal A

Strand

+

Peptide

GLLGGGLEEGSPGGGAWR

Modified Peptide

n[145]GLLGGGLEEGSPGGGAWR

Peptide Length

18

ORF Length

97

Open Reading Frame (ORF)

LGAEHLREEHLAGSLGGGGTWGRKSGGGVSWWGAWRRGLLGEGPGGGVSWGRGLEEGSPGGGAWRRGLLGGGLEEGSPGGGAWRRGLLGEGPLGSQP

Conservation Score

0.293

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.994058

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.3697

PhyloCSF Frame 3

0

CNTI Score

0.739900922