McDonnell Genome Institute

Washington University

Transcript

lnc-PWP2-1:6

Chromosome

chr21

Gene Name

lnc-PWP2-1

Start

44175454

CPC Label

coding

End

44189556

Cancer

PRAD

Strand

+

Peptide

DAKPQDPPELPSLPMAPSAHPR

Modified Peptide

DAKPQDPPELPSLPM[147]APSAHPR

Peptide Length

22

ORF Length

274

Open Reading Frame (ORF)

LRVPAPLLLLVTHLPLKQPRPHQCLGNPSEAPPCQTPGVGASAPPAASATGPFGESVLPKEASPGDAGAWPSLLSAPSTWYKGHSSQSLSPEDSGGQPETQDPLPPAPGANASLASGRDQHRGCGWGGWCWRQGACWRSFGGGGQPHTLLAMVRQAVAPGAGCFPSSDLGFSSASPCLPRDAKPQDPPELPSLPMAPSAHPRGWTFAGGQAMPASTSGDLCGHLRVLCTVRGAVGTELPAPRGLLCSCSLDLEEPYPHRHARQMRLQTRVMNAA

Conservation Score

0.042

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

1

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.262944042