McDonnell Genome Institute

Washington University

Transcript

lnc-PWP2-1:4

Chromosome

chr21

Gene Name

lnc-PWP2-1

Start

44175454

CPC Label

noncoding

End

44178850

Cancer

OSCC

Strand

+

Peptide

LAELEAGRQIGL

Modified Peptide

n[145]LAELEAGRQIGL

Peptide Length

12

ORF Length

80

Open Reading Frame (ORF)

LPRGNGEAQVFWAELSVPQGVPQLLASGRPRTAFPRATASRSPPIVAGPLLGGECPTDEGLKATGMPRLAELEAGRQIGL

Conservation Score

0.64

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.107585

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6419

PhyloCSF Frame 3

0

CNTI Score

-0.310242315