McDonnell Genome Institute

Washington University

Transcript

lnc-PWP2-1:3

Chromosome

chr21

Gene Name

lnc-PWP2-1

Start

44175454

CPC Label

noncoding

End

44178850

Cancer

LUAD

Strand

+

Peptide

TGVPGVPGVR

Modified Peptide

n[230]TGVPGVPGVR

Peptide Length

10

ORF Length

47

Open Reading Frame (ORF)

LRASVLGLLQVTAHRHPGASPSDCEQASWGFSERLRTGVPGVPGVRM

Conservation Score

0.734

PhyloCSF Frame 1

0

No. of Spectra

49

CPC Coding Probability

0.0593826

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9945

PhyloCSF Frame 3

0

CNTI Score

-0.321088544