McDonnell Genome Institute

Washington University

Transcript

lnc-PWP1-3:1

Chromosome

chr12

Gene Name

lnc-PWP1-3

Start

107333942

CPC Label

noncoding

End

107335261

Cancer

BRCA-Luminal A

Strand

+

Peptide

AGLEMAGK

Modified Peptide

n[145]AGLEMAGK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LKGFWFEQRGGVVLTETGNTVERAGLEMAGKSGLQLGTCKVRGIF

Conservation Score

0.515

PhyloCSF Frame 1

-4.736

No. of Spectra

5

CPC Coding Probability

0.0239419

PhyloCSF Frame 2 

-4.222

CNTI Index

noncoding

Max Probability

0.9955

PhyloCSF Frame 3

-4.656

CNTI Score

-0.315091359