McDonnell Genome Institute

Washington University

Transcript

lnc-PUS7L-1:1

Chromosome

chr12

Gene Name

lnc-PUS7L-1

Start

43718992

CPC Label

noncoding

End

43724000

Cancer

OV

Strand

-

Peptide

YVWILEYLYMYNEILLELGPK

Modified Peptide

n[145]YVWILEYLYM[147]YNEILLELGPK

Peptide Length

21

ORF Length

83

Open Reading Frame (ORF)

LQVWPQIFKWLLSLLHSTYPLLQLFHKYRLNIPYLKCLGLKVSDFRYVWILEYLYMYNEILLELGPKSKQNSFMFHIYLIHIT

Conservation Score

0.205

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0451858

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7656

PhyloCSF Frame 3

0

CNTI Score

-0.411674857