McDonnell Genome Institute

Washington University

Transcript

lnc-PUS7-1:2

Chromosome

chr7

Gene Name

lnc-PUS7-1

Start

105527964

CPC Label

noncoding

End

105532069

Cancer

OV

Strand

-

Peptide

LTVVFIDIGR

Modified Peptide

n[145]LTVVFIDIGR

Peptide Length

10

ORF Length

73

Open Reading Frame (ORF)

LMTVLERFSTTILAAGGGRWWSQSTTNPKSSKSILFKSDLTSSSTMLVRVSCLRVQRLTVVFIDIGRHGCPAV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.125799

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.895

PhyloCSF Frame 3

0

CNTI Score

-0.340325318