McDonnell Genome Institute

Washington University

Transcript

lnc-PUS3-2:6

Chromosome

chr11

Gene Name

lnc-PUS3-2

Start

125924342

CPC Label

noncoding

End

125926099

Cancer

CCRC

Strand

-

Peptide

IAYSSDR

Modified Peptide

n[230]IAYSSDR

Peptide Length

7

ORF Length

73

Open Reading Frame (ORF)

LSLSEDQEPSQGLTKPASLSLLSGKAGTERDDLGQAMQEDGKIAYSSDRSCTLQKTAFGLLTHQTSQFVLMQL

Conservation Score

0.993

PhyloCSF Frame 1

-2.649

No. of Spectra

14

CPC Coding Probability

0.384124

PhyloCSF Frame 2 

-2.404

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

-4.068

CNTI Score

-0.398150175