McDonnell Genome Institute

Washington University

Transcript

lnc-PUS3-1:1

Chromosome

chr11

Gene Name

lnc-PUS3-1

Start

125873448

CPC Label

noncoding

End

125874528

Cancer

LUAD

Strand

-

Peptide

QYLIYIGPR

Modified Peptide

n[230]QYLIYIGPR

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

LRWEAAGFIEGLRRQYLIYIGPRDLVGPSVPFT

Conservation Score

0.544

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0421913

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8912

PhyloCSF Frame 3

0

CNTI Score

-0.338313332