McDonnell Genome Institute

Washington University

Transcript

lnc-PUM3-9:1

Chromosome

chr9

Gene Name

lnc-PUM3-9

Start

1917164

CPC Label

noncoding

End

1930573

Cancer

OV

Strand

-

Peptide

LYTHLMLWFNENICK

Modified Peptide

n[145]LYTHLMLWFNENICK

Peptide Length

15

ORF Length

39

Open Reading Frame (ORF)

MLYTHLMLWFNENICKRPNRVVACGRKTSDLSSFSPYFR

Conservation Score

0.163

PhyloCSF Frame 1

-4.279

No. of Spectra

2

CPC Coding Probability

0.0420288

PhyloCSF Frame 2 

-3.822

CNTI Index

noncoding

Max Probability

0.3202

PhyloCSF Frame 3

-4.61

CNTI Score

-0.377390999