McDonnell Genome Institute

Washington University

Transcript

lnc-PUM3-5:1

Chromosome

chr9

Gene Name

lnc-PUM3-5

Start

2900319

CPC Label

noncoding

End

2900804

Cancer

EOGC

Strand

-

Peptide

AGIVEYEK

Modified Peptide

n[145]AGIVEYEK

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

LDAEDKEDVKSCAEWVSLSKAGIVEYEKQKEKMKNLIPFDQMTIEDLKKTFPETKLDKKKYP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0187543

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.2958

PhyloCSF Frame 3

0

CNTI Score

0.647871648