McDonnell Genome Institute

Washington University

Transcript

lnc-PTS-1:6

Chromosome

chr11

Gene Name

lnc-PTS-1

Start

112269216

CPC Label

coding

End

112272929

Cancer

OV

Strand

+

Peptide

VELAEGR

Modified Peptide

n[145]VELAEGR

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

MYAVQLVTSLHGIRGKVELAEGRWKRRATNSSFL

Conservation Score

0.907

PhyloCSF Frame 1

-4.083

No. of Spectra

1

CPC Coding Probability

0.809342

PhyloCSF Frame 2 

-5.444

CNTI Index

noncoding

Max Probability

0.5791

PhyloCSF Frame 3

-5.331

CNTI Score

-0.328531795