McDonnell Genome Institute

Washington University

Transcript

lnc-PTS-1:5

Chromosome

chr11

Gene Name

lnc-PTS-1

Start

112292572

CPC Label

noncoding

End

112294116

Cancer

EOGC

Strand

+

Peptide

LLDFAFLPNLLLLLK

Modified Peptide

n[145]LLDFAFLPNLLLLLK

Peptide Length

15

ORF Length

35

Open Reading Frame (ORF)

LLDFAFLPNLLLLLKKENNLDNEMISNEVIKSLLN

Conservation Score

0.999

PhyloCSF Frame 1

-4.384

No. of Spectra

1

CPC Coding Probability

0.0159029

PhyloCSF Frame 2 

-3.541

CNTI Index

noncoding

Max Probability

0.5695

PhyloCSF Frame 3

-6.036

CNTI Score

-0.359628408