McDonnell Genome Institute

Washington University

Transcript

lnc-PTS-1:20

Chromosome

chr11

Gene Name

lnc-PTS-1

Start

112270747

CPC Label

noncoding

End

112279713

Cancer

CRC

Strand

+

Peptide

LILQPEIK

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

MLAVLSLTGDIAVIFISFFEFFPFTNEHRLILQPEIKYCT

Conservation Score

0.971

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.034997

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8814

PhyloCSF Frame 3

0

CNTI Score

-0.344263569