McDonnell Genome Institute

Washington University

Transcript

lnc-PTRH2-3:3

Chromosome

chr17

Gene Name

lnc-PTRH2-3

Start

59618552

CPC Label

noncoding

End

59619831

Cancer

OV

Strand

-

Peptide

LTPHGGK

Modified Peptide

n[145]LTPHGGK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

LTPHGGKQRNRRDYFFRLITFASLLFLPPLFFFHFATSCDSGRPTSLPWAL

Conservation Score

1

PhyloCSF Frame 1

1.971

No. of Spectra

6

CPC Coding Probability

0.0327165

PhyloCSF Frame 2 

-1.132

CNTI Index

noncoding

Max Probability

0.9914

PhyloCSF Frame 3

3.446

CNTI Score

-0.346184484