McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRZ1-3:1

Chromosome

chr7

Gene Name

lnc-PTPRZ1-3

Start

122328468

CPC Label

noncoding

End

122378946

Cancer

OV

Strand

+

Peptide

RPYQILHVIGR

Modified Peptide

n[145]RPYQILHVIGR

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

LRNYLFEALFQLTPKRPYQILHVIGRRECLTAAPDLICYS

Conservation Score

0.967

PhyloCSF Frame 1

-4.631

No. of Spectra

1

CPC Coding Probability

0.0802881

PhyloCSF Frame 2 

-5.648

CNTI Index

noncoding

Max Probability

0.6338

PhyloCSF Frame 3

-5.455

CNTI Score

-0.398029943