McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRZ1-11:1

Chromosome

chr7

Gene Name

lnc-PTPRZ1-11

Start

122257884

CPC Label

noncoding

End

122264674

Cancer

BRCA-Luminal B

Strand

+

Peptide

GEKSPSLVHR

Modified Peptide

n[145]GEKSPSLVHR

Peptide Length

10

ORF Length

68

Open Reading Frame (ORF)

LECSGTIIAQQCCKLASPSADTYSRWCHTPKDRGEKSPSLVHRCTGSVCVCQPKIGCYCTIASPGGRV

Conservation Score

0.049

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0227812

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

0

CNTI Score

-0.390249382