McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRZ1-10:1

Chromosome

chr7

Gene Name

lnc-PTPRZ1-10

Start

122234530

CPC Label

noncoding

End

122234903

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

CIHGVGLR

Modified Peptide

n[145]CIHGVGLR

Peptide Length

8

ORF Length

53

Open Reading Frame (ORF)

MAPAKKGDEKKKGHSAINEVVTREYTINIHKCIHGVGLRSVPLGNSKRFCNLP

Conservation Score

1

PhyloCSF Frame 1

-3.988

No. of Spectra

1

CPC Coding Probability

0.0331999

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9737

PhyloCSF Frame 3

-4.752

CNTI Score

-0.33689263