McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRU-3:1

Chromosome

chr1

Gene Name

lnc-PTPRU-3

Start

29711701

CPC Label

coding

End

29712567

Cancer

OV

Strand

+

Peptide

EGSSLPQDSRR

Modified Peptide

n[145]EGSSLPQDSRR

Peptide Length

11

ORF Length

163

Open Reading Frame (ORF)

MKCKDVVPQKGAKHEMTLERVTASEAHSGLHGMGPKDREGSSLPQDSRRLPHRHCSCKCLCWQRLPVVSESLCSGFITISFCKNSHFCREIYSAWPAGQEQKRKAKWGQCGVLCGIDPACLCRGCREGDLVGGIRWHVLSTYYVLGTVLACWLLACCNSFNIQ

Conservation Score

0.666

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.869859

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9809

PhyloCSF Frame 3

0

CNTI Score

-0.393894644