McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRU-20:1

Chromosome

chr1

Gene Name

lnc-PTPRU-20

Start

29755174

CPC Label

noncoding

End

29790597

Cancer

OV

Strand

+

Peptide

TLQSSPWAQIR

Modified Peptide

n[145]TLQSSPWAQIR

Peptide Length

11

ORF Length

56

Open Reading Frame (ORF)

MGTKGLAHSRRQDSHVVPQRTLQSSPWAQIRARLDQVHALAWLLAHPPLLPSLPFF

Conservation Score

0.024

PhyloCSF Frame 1

-5.668

No. of Spectra

4

CPC Coding Probability

0.217195

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4745

PhyloCSF Frame 3

0

CNTI Score

-0.352308069